VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Purity

Greater than 95.0% as determined by analysis by SDS-PAGE.

Product Form

Sterile filtered colorless solution.

Formulation

IL-6 is a sterile filtered (0.22Âµm) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2.

Storage

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

Synonyms

B cell differentiation factor , B cell stimulatory factor 2, B-cell stimulatory factor 2, BSF 2, BSF-2, BSF2, CDF, CTL differentiation factor, Cytotoxic T cell differentiation factor , Hepatocyte stimulating fact, Hepatocyte stimulating factor, Hepatocyte stimulatory factor, HGF, HPGF, HSF , Hybridoma growth factor, Hybridoma growth factor Interferon beta-2, Hybridoma plasmacytoma growth factor , IFN-beta-2, IFNB2 , IL-6, IL6, IL6 protein , IL6_HUMAN, Interferon beta 2, Interferon beta-2, Interleukin 6, Interleukin 6 (interferon beta 2) , Interleukin BSF 2, Interleukin BSF2, Interleukin-6, Interleukin6

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Publishing research using IL 6 Human, CHO (A61513)? Please let us know so that we can list the citation on this page.