+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-Integrin alpha V Antibody (A13861)

Western Blot - Anti-Integrin alpha V Antibody (A13861) - Antibodies.com Western Blot - Anti-Integrin alpha V Antibody (A13861) - Antibodies.com Immunohistochemistry - Anti-Integrin alpha V Antibody (A13861) - Antibodies.com Western Blot - Anti-Integrin alpha V Antibody (A13861) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to Integrin alpha V for WB, IHC and IP.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-Integrin alpha V Antibody
Description
Rabbit polyclonal antibody to Integrin alpha V.
Applications
WB, IHC, IP
Dilutions
WB: 1:1,000-1:5,000, IHC: 1:50-1:200, IP: 1:1,000-1:5,000
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 950 to the C-terminus of human Integrin alpha V (ITGAV/CD51) (NP_002201.1).
Sequence
LKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
130 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
antigen identified by monoclonal, CD 51, CD51, DKFZp686A08142, Integrin alpha five, integrin alpha V beta 3, Integrin alpha-5, integrin alpha-V, Integrin alpha-V light chain, integrin alphaVbeta3, integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51), ITAV_HUMAN, ITGAV, MSK 8, Msk8, Vitronectin receptor subunit alpha, VNRA, VTNR
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-Integrin alpha V Antibody (A13861) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-Integrin alpha V Antibody (A13861)
Western blot analysis of extracts of various cell lines, using Anti-Integrin alpha V Antibody (A13861) at 1:3,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3s.
Western Blot - Anti-Integrin alpha V Antibody (A13861) - Antibodies.comEnlarge Image
Figure 2: Western Blot - Anti-Integrin alpha V Antibody (A13861)
Western blot analysis of extracts of MCF7 cells, using Anti-Integrin alpha V Antibody (A13861) at 1:3,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry - Anti-Integrin alpha V Antibody (A13861) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-Integrin alpha V Antibody (A13861)
Immunohistochemistry analysis of paraffin-embedded rat testis using Anti-Integrin alpha V Antibody (A13861) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Western Blot - Anti-Integrin alpha V Antibody (A13861) - Antibodies.comEnlarge Image
Figure 4: Western Blot - Anti-Integrin alpha V Antibody (A13861)
Immunoprecipitation analysis of 200µg extracts of C6 cells using 3µg of Anti-Integrin alpha V Antibody (A13861). This Western blot was performed on the immunoprecipitate using Anti-Integrin alpha V Antibody (A13861) at a dilution of 1:2000.
Publishing research using Anti-Integrin alpha V Antibody (A13861)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Integrin alpha V Antibody (A13861)

Flow Cytometry - Anti-CD51/CD61 Antibody [23C6] (A242877) - Antibodies.com
A242878
6 Citations
Anti-Integrin alpha V beta 3 Antibody [23C6]
Mouse monoclonal [23C6] antibody to Integrin alpha V beta 3 for IP, IHC-Fr and Flow Cytometry.
Western Blot - Anti-Integrin alpha V Antibody [ARC50621] (A308725) - Antibodies.com
(6)
A308725
Anti-Integrin alpha V Antibody [ARC50621]
Rabbit monoclonal [ARC50621] antibody to Integrin alpha V for WB, IHC and Flow Cytometry.
SDS-PAGE - Abituzumab Biosimilar - Anti-Integrin alpha V Antibody - Low endotoxin, Azide free (A323263) - Antibodies.com
(2)
A323263
Abituzumab Biosimilar - Anti-Integrin alpha V Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to Integrin alpha V for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Intetumumab Biosimilar - Anti-Integrin alpha V Antibody - Low endotoxin, Azide free (A323514) - Antibodies.com
(2)
A323514
Intetumumab Biosimilar - Anti-Integrin alpha V Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to Integrin alpha V for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Integrin alpha V Antibody [ITGAV/1610] - BSA and Azide free (A252248) - Antibodies.com
A252250
Anti-Integrin alpha V Antibody [ITGAV/1610] - BSA and Azide free
Mouse monoclonal [ITGAV/1610] antibody to Integrin alpha V for ELISA, Flow Cytometry, IF and WB.
SDS-PAGE - Anti-Integrin alpha V Antibody [ITGAV/1610] (A249068) - Antibodies.com
A249070
Anti-Integrin alpha V Antibody [ITGAV/1610]
Mouse monoclonal [ITGAV/1610] antibody to Integrin alpha V for ELISA, Flow Cytometry, IF and WB.
Antibodies.com Image Placeholder - Discover more for less
A115664
Anti-Integrin alpha V Antibody [NKI-M7]
Mouse monoclonal [NKI-M7] antbody to Integrin alpha V for ELISA, Flow Cytometry, IHC-Fr and IP.
Antibodies.com Image Placeholder - Discover more for less
A281693
Anti-Integrin alpha V Antibody [RMV-7]
Rat monoclonal [RMV-7] antibody to Integrin alpha V for IP, Flow Cytometry and IHC-Fr.
Antibodies.com Image Placeholder - Discover more for less
A281694
Anti-Integrin alpha V Antibody [RMV-7] - BSA and Azide free
Rat monoclonal [RMV-7] antibody to Integrin alpha V for Flow Cytometry, IP and Functional Assays.
SDS-PAGE - Anti-Integrin alpha V Antibody [23C6] (A250848) - Antibodies.com
A250849
Anti-Integrin alpha V Antibody [23C6]
Mouse monoclonal [23C6] antibody to Integrin alpha V for ELISA.
SDS-PAGE - Anti-Integrin alpha V Antibody [23C6] - BSA and Azide free (A254028) - Antibodies.com
A254029
Anti-Integrin alpha V Antibody [23C6] - BSA and Azide free
Mouse monoclonal [23C6] antibody to Integrin alpha V for ELISA.
Antibodies.com Image Placeholder - Discover more for less
A115655
Anti-Integrin alpha V Antibody [NKI-M9]
Mouse monoclonal [NKI-M9] antbody to Integrin alpha V for IF, IHC-Fr and IP.
Flow Cytometry - Anti-CD51/CD61 Antibody [23C6] (A242877) - Antibodies.com
A242878
6 Citations
Anti-Integrin alpha V beta 3 Antibody [23C6]
Mouse monoclonal [23C6] antibody to Integrin alpha V beta 3 for IP, IHC-Fr and Flow Cytometry.
Western Blot - Anti-Integrin alpha V Antibody [ARC50621] (A308725) - Antibodies.com
(6)
A308725
Anti-Integrin alpha V Antibody [ARC50621]
Rabbit monoclonal [ARC50621] antibody to Integrin alpha V for WB, IHC and Flow Cytometry.
SDS-PAGE - Abituzumab Biosimilar - Anti-Integrin alpha V Antibody - Low endotoxin, Azide free (A323263) - Antibodies.com
(2)
A323263
Abituzumab Biosimilar - Anti-Integrin alpha V Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to Integrin alpha V for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Intetumumab Biosimilar - Anti-Integrin alpha V Antibody - Low endotoxin, Azide free (A323514) - Antibodies.com
(2)
A323514
Intetumumab Biosimilar - Anti-Integrin alpha V Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to Integrin alpha V for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Integrin alpha V Antibody [ITGAV/1610] - BSA and Azide free (A252248) - Antibodies.com
A252250
Anti-Integrin alpha V Antibody [ITGAV/1610] - BSA and Azide free
Mouse monoclonal [ITGAV/1610] antibody to Integrin alpha V for ELISA, Flow Cytometry, IF and WB.
SDS-PAGE - Anti-Integrin alpha V Antibody [ITGAV/1610] (A249068) - Antibodies.com
A249070
Anti-Integrin alpha V Antibody [ITGAV/1610]
Mouse monoclonal [ITGAV/1610] antibody to Integrin alpha V for ELISA, Flow Cytometry, IF and WB.
Antibodies.com Image Placeholder - Discover more for less
A115664
Anti-Integrin alpha V Antibody [NKI-M7]
Mouse monoclonal [NKI-M7] antbody to Integrin alpha V for ELISA, Flow Cytometry, IHC-Fr and IP.
Antibodies.com Image Placeholder - Discover more for less
A281693
Anti-Integrin alpha V Antibody [RMV-7]
Rat monoclonal [RMV-7] antibody to Integrin alpha V for IP, Flow Cytometry and IHC-Fr.
Antibodies.com Image Placeholder - Discover more for less
A281694
Anti-Integrin alpha V Antibody [RMV-7] - BSA and Azide free
Rat monoclonal [RMV-7] antibody to Integrin alpha V for Flow Cytometry, IP and Functional Assays.
SDS-PAGE - Anti-Integrin alpha V Antibody [23C6] (A250848) - Antibodies.com
A250849
Anti-Integrin alpha V Antibody [23C6]
Mouse monoclonal [23C6] antibody to Integrin alpha V for ELISA.
SDS-PAGE - Anti-Integrin alpha V Antibody [23C6] - BSA and Azide free (A254028) - Antibodies.com
A254029
Anti-Integrin alpha V Antibody [23C6] - BSA and Azide free
Mouse monoclonal [23C6] antibody to Integrin alpha V for ELISA.
Antibodies.com Image Placeholder - Discover more for less
A115655
Anti-Integrin alpha V Antibody [NKI-M9]
Mouse monoclonal [NKI-M9] antbody to Integrin alpha V for IF, IHC-Fr and IP.
See all Anti-Integrin alpha V Antibodies
Main Menu Contact Us 0Checkout
Top