Anti-Histone H3 Anticorpo (A16702)

Anti-Histone H3 Antibody

Rabbit polyclonal antibody to Histone H3.

WB, IHC, IP, ChIP

WB: 1:500-1:1,000, IHC: 1:50-1:200, IP: 1:10,000-1:30,000, ChIP: 1:10,000-1:30,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human HIST3H3 (NP_003484.1).

REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

17 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Cit Histone H3, Citrullated, citrullin, Citrullinated Histone H3, citrulline, FLJ92264, H 3, H3, H3 3 like sequence MH921, H3 3A, H3 a, H3 b, H3 c, H3 d, H3 f, H3 h, H3 histone, H3 histone family member E pseudogene, H3 histone family, member A, H3 histone family, member B, H3 histone family, member C, H3 histone family, member D, H3 histone family, member F, H3 histone family, member H, H3 histone family, member I, H3 histone family, member J, H3 histone family, member K, H3 histone family, member L, H3 histone family, member T, H3 histone, family 3A, H3 i, H3 j, H3 k, H3 l, H3.1, H3.3A, H3/A, H3/b, H3/c, H3/d, h3/f, H3/h, H3/i, H3/j, H3/k, H3/l, H3/t, H31_HUMAN, H33_HUMAN, H3F1K, H3F3, H3F3A, H3f3b, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, HIST1 cluster, H3A, HIST1 cluster, H3B, HIST1 cluster, H3C, HIST1 cluster, H3D, HIST1 cluster, H3E, HIST1 cluster, H3F, HIST1 cluster, H3G, HIST1 cluster, H3H, HIST1 cluster, H3I, HIST1 cluster, H3J, Hist1h3a, HIST1H3B, HIST1H3C, HIST1H3D, HIST1H3E, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H3I, HIST1H3J, HIST3H3, HIST3HA, histone 1, H3a, Histone 1, H3b, Histone 1, H3c, Histone 1, H3d, Histone 1, H3e, Histone 1, H3f, Histone 1, H3g, Histone 1, H3h, Histone 1, H3i, Histone 1, H3j, Histone 3, H3, histone cluster 1 H3 family member a, histone cluster 1 H3 family member b, histone cluster 1 H3 family member c, histone cluster 1 H3 family member d, histone cluster 1 H3 family member e, histone cluster 1 H3 family member f, histone cluster 1 H3 family member g, histone cluster 1 H3 family member h, histone cluster 1 H3 family member i, histone cluster 1 H3 family member j, Histone cluster 1, H3a, Histone cluster 1, H3b, Histone cluster 1, H3c, Histone cluster 1, H3d, Histone cluster 1, H3e, Histone cluster 1, H3f, Histone cluster 1, H3g, Histone cluster 1, H3i, Histone cluster 1, H3j, Histone gene cluster 1, H3 histone family, member A, Histone gene cluster 1, H3 histone family, member B, Histone gene cluster 1, H3 histone family, member C, Histone gene cluster 1, H3 histone family, member D, Histone gene cluster 1, H3 histone family, member E, Histone gene cluster 1, H3 histone family, member F, Histone gene cluster 1, H3 histone family, member G, Histone gene cluster 1, H3 histone family, member H, Histone gene cluster 1, H3 histone family, member I, Histone gene cluster 1, H3 histone family, member J, Histone gene cluster 1, H3A, Histone gene cluster 1, H3B, Histone gene cluster 1, H3C, Histone gene cluster 1, H3D, Histone gene cluster 1, H3E, Histone gene cluster 1, H3F, Histone gene cluster 1, H3G, Histone gene cluster 1, H3H, Histone gene cluster 1, H3I, Histone gene cluster 1, H3J, Histone H 3, Histone H3 3 pseudogene, Histone H3 Citrullated, Histone H3.1, Histone H3.1t, Histone H3.2, Histone H3.3, Histone H3.3C, Histone H3.5, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l, Histone H3/m, Histone H3/o