Anti-ITGB3BP Antibody (A91907)

Anti-ITGB3BP Antibody

Rabbit polyclonal antibody to ITGB3BP.

IHC: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human ITGB3BP (NP_055103.3).

MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQ

Rabbit

Polyclonal

IgG

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Beta 3 endonexin, Beta3 endonexin, Beta3 endonexin long form, CENP R, CENPR, CENPR_HUMAN, Centromere protein R, endonexin, Beta-3, HSU37139, Integrin beta 3 binding protein, Integrin beta 3 binding protein (beta3-endonexin), NRIF 3, NRIF3, Nuclear receptor interacting factor 3, TAP 20, TAP20