Anti-JNK3 Antibody (A90363)

Anti-JNK3 Antibody

Rabbit polyclonal antibody to JNK3.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 300-400 of human JNK3 (NP_620448.1).

NRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMN

Rabbit

Polyclonal

IgG

Unconjugated

52 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

c Jun kinase 3, c-Jun N-terminal kinase 3, cJun N terminal kinase 3, FLJ12099, FLJ33785, JNK3 alpha protein kinase, JNK3A, MAP kinase, MAP kinase 10, MAP kinase p49 3F12, MAPK 10, Mapk10, MGC50974, mitogen activated protein kinase 10, Mitogen-activated protein kinase 10, MK10_HUMAN, p493F12, p54bSAPK, PRKM10, protein kinase mitogen activated 10, SAPK1b, Stress activated protein kinase 1b, stress activated protein kinase beta, Stress activated protein kinase JNK3, Stress-activated protein kinase JNK3