Anti-JWA Antibody (A88763)

Anti-JWA Antibody

Rabbit polyclonal antibody to JWA.

WB: 1:500-1:2,000

Mouse

A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human ARL6IP5 (NP_006398.1).

TFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Addicsin, ADP ribosylation factor like protein 6 interacting protein 5, ADP ribosylation like factor 6 interacting protein 5, ADP-ribosylation factor-like protein 6-interacting protein 5, Aip 5, Aip-5, Aip5, ARL 6 interacting protein 5, ARL-6-interacting protein 5, ARL6IP5, Cytoskeleton related vitamin A responsive protein, Cytoskeleton-related vitamin A-responsive protein, Dermal papilla derived protein 11, Dermal papilla-derived protein 11, DERP 11, DERP11, Glutamate transporter EAAC1-interacting protein, Glutamate transporter EEAC 1 associated protein, Glutamate transporter EEAC1 associated protein, GTRAP3 18, GTRAP3-18, Hp 22, Hp22, HSPC 127, HSPC127, JM 5, JM5, JMX, PRA 1 domain family 3, PRA 2, PRA1 domain family 3, PRA1 family protein 3, PRA2, PRAF 3, PRAF3, PRAF3_HUMAN, Prenylated Rab acceptor protein 2, Protein JWa, Putative MAPK activating protein PM27, Putative MAPK-activating protein PM27