Anti-KCNE2 Antibody (A91917)

Anti-KCNE2 Antibody

Rabbit polyclonal antibody to KCNE2.

WB: 1:500-1:2000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human KCNE2 (NP_751951.1).

MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Minimum potassium ion channel-related peptide 1, MinK-related peptide 1, MiRP1, Potassium channel subunit beta MiRP1, Potassium voltage-gated channel subfamily E member 2