Anti-KDM2A Antibody (A307258)

Anti-KDM2A Antibody

Rabbit polyclonal antibody to KDM2A.

WB: 1:500-1:1,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KDM2A (NP_036440.1).

MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKM

Rabbit

Polyclonal

IgG

Unconjugated

126 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CXXC-type zinc finger protein 8, CXXC8, F box / LRR repeat protein 11, F box and leucine rich repeat protein 11, F box protein FBL7, F-box and leucine-rich repeat protein 11, F-box protein FBL7, F-box protein Lilina, F-box/LRR-repeat protein 11, FBL11, FBL7, FBXL11, JHDM1A, JmjC domain-containing histone demethylation protein 1A, Jumonji C domain containing histone demethylase 1A, KDM2A_HUMAN, LILINA, Lysine (K) specific demethylase 2A, Lysine-specific demethylase 2A, [Histone-H3]-lysine-36 demethylase 1A