Anti-KIAA0391 Antibody (A92364)

Anti-KIAA0391 Antibody

Rabbit polyclonal antibody to KIAA0391.

WB: 1:500-1:2000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 314-583 of human KIAA0391 (NP_055487.2).

YPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSGCGKTIESIQLSPEEYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVAKMFPKVRESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADDISEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPYDEDLVERCSCEVPTKWLCLHQKT

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Mitochondrial ribonuclease P catalytic subunit, Mitochondrial ribonuclease P protein 3, Mitochondrial RNase P protein 3, PRORP, Protein only RNase P catalytic subunit