Anti-KIR3DL1 Antibody (A92270)

Anti-KIR3DL1 Antibody

Rabbit polyclonal antibody to KIR3DL1.

WB: 1:500-1:2000

Human, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 22-222 of human KIR3DL1 (NP_037421.2).

HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYE

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CD158 antigen-like family member E, CD158e, HLA-BW4-specific inhibitory NK cell receptor, Killer cell immunoglobulin-like receptor 3DL1, Natural killer-associated transcript 3, NKAT-3, NKAT3, NKB1, p70 natural killer cell receptor clones CL-2/CL-11, p70 NK receptor CL-2/CL-11