Anti-KLF13 Antibody (A93089)

Anti-KLF13 Antibody

Rabbit polyclonal antibody to KLF13.

WB: 1:500-1:1,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KLF13 (NP_057079.2).

PPAPEPTSPGAEGAAAAPPSPAWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACS

Rabbit

Polyclonal

IgG

Unconjugated

45 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Basic transcription element binding protein 3, Basic transcription element-binding protein 3, BTE binding protein 3, BTE-binding protein 3, BTEB3, C2 H2 zinc finger protein, FKLF 2, FKLF2, KLF13_HUMAN, Krueppel-like factor 13, Kruppel like factor 13, Novel Sp1 like zinc finger transcription factor, Novel Sp1-like zinc finger transcription factor 1, NSLP1, RANTES factor of late activated T lymphocytes 1, RANTES factor of late activated T-lymphocytes 1, RFLAT 1, RFLAT-1, RFLAT1, Transcription factor BTEB3, Transcription factor NSLP1