Anti-KPNA2 Antibody [ARC1227] (A307873)

Anti-KPNA2 Antibody [ARC1227]

Rabbit monoclonal [ARC1227] antibody to KPNA2.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KPNA2 (P52292).

MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAA

Rabbit

Monoclonal

ARC1227

IgG

Affinity purification.

58 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

IMA1_HUMAN, Importin alpha 1, Importin alpha 2, Importin alpha 2 subunit, Importin alpha P1, Importin subunit alpha-1, IPO A1, IPOA 1, IPOA1, Karyopherin alpha 2, Karyopherin alpha 2 RAG cohort 1, Karyopherin alpha 2 subunit, Karyopherin subunit alpha-2, KPNA2 protein, Pendulin, QIP 2, QIP2, RAG cohort 1, RAG cohort protein 1, RCH 1, RCH1, SRP 1, SRP1, SRP1 alpha, SRP1-alpha, SRP1alpha