+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-Lambda Light chain Antibody [ARC2357] (A307901)

Western Blot - Anti-Lambda Light chain Antibody [ARC2357] (A307901) - Antibodies.com Western Blot - Anti-Lambda Light chain Antibody [ARC2357] (A307901) - Antibodies.com Immunohistochemistry - Anti-Lambda Light chain Antibody [ARC2357] (A307901) - Antibodies.com Immunohistochemistry - Anti-Lambda Light chain Antibody [ARC2357] (A307901) - Antibodies.com
$470
Product Datasheet

Rabbit monoclonal [ARC2357] antibody to Lambda Light chain for WB and IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-Lambda Light chain Antibody [ARC2357]
Description
Rabbit monoclonal [ARC2357] antibody to Lambda Light chain.
Applications
WB, IHC
Dilutions
WB: 1:500-1:1,000, IHC: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human Lambda Light chain (P01701).
Sequence
MTCSPLLLTLLIHCTGSWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC2357
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
25 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
Bence Jones protein, BJP, Constant region of lambda light chains, Ig lambda chain C regions, ig lambda-6 chain C region, IGLC, IGLC 1, IGLC 2, IGLC 3, IGLC1, IGLC2, IGLC3, IGLC6, IGLV, Immunoglobulin lambda constant 1, Immunoglobulin lambda constant regin 1, immunoglobulin lambda gene cluster, Immunoglobulin lambda locus, Immunoglobulin lambda variable cluster, Immunoglobulin: lambda light chain, Mcg marker, Paraprotein
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-Lambda Light chain Antibody [ARC2357] (A307901) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-Lambda Light chain Antibody [ARC2357] (A307901)
Western blot analysis of extracts of Mouse spleen, using Anti-Lambda Light chain Antibody [ARC2357] (A307901) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.
Western Blot - Anti-Lambda Light chain Antibody [ARC2357] (A307901) - Antibodies.comEnlarge Image
Figure 2: Western Blot - Anti-Lambda Light chain Antibody [ARC2357] (A307901)
Western blot analysis of extracts of Rat spleen, using Anti-Lambda Light chain Antibody [ARC2357] (A307901) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry - Anti-Lambda Light chain Antibody [ARC2357] (A307901) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-Lambda Light chain Antibody [ARC2357] (A307901)
Immunohistochemistry analysis of paraffin-embedded human cervix cancer tissue using Anti-Lambda Light chain Antibody [ARC2357] (A307901) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-Lambda Light chain Antibody [ARC2357] (A307901) - Antibodies.comEnlarge Image
Figure 4: Immunohistochemistry - Anti-Lambda Light chain Antibody [ARC2357] (A307901)
Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-Lambda Light chain Antibody [ARC2357] (A307901) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Publishing research using Anti-Lambda Light chain Antibody [ARC2357] (A307901)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Lambda Light chain Antibody [ARC2357] (A307901)

Immunohistochemistry - Anti-Lambda Light Chain Antibody [HP6054] (A248992) - Antibodies.com
(5)
A248992
Anti-Lambda Light Chain Antibody [HP6054]
Mouse monoclonal [HP6054] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [HP6054] - BSA and Azide free (A252172) - Antibodies.com
(5)
A252172
Anti-Lambda Light Chain Antibody [HP6054] - BSA and Azide free
Mouse monoclonal [HP6054] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [LcN-2] - BSA and Azide free (A252173) - Antibodies.com
(4)
A252173
Anti-Lambda Light Chain Antibody [LcN-2] - BSA and Azide free
Mouse monoclonal [LcN-2] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [LcN-2] (A248993) - Antibodies.com
(4)
A248993
Anti-Lambda Light Chain Antibody [LcN-2]
Mouse monoclonal [LcN-2] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [RM127] (A121310) - Antibodies.com
(4)
A121310
Anti-Lambda Light Chain Antibody [RM127]
Recombinant rabbit monoclonal [RM127] antibody to Lambda Light Chain for ICC, IHC, Flow Cytometry and ELISA.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [SPM559] (A248993) - Antibodies.com
(2)
A248994
Anti-Lambda Light Chain Antibody [SPM559]
Mouse monoclonal [SPM559] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [SPM559] - BSA and Azide free (A252173) - Antibodies.com
(2)
A252174
Anti-Lambda Light Chain Antibody [SPM559] - BSA and Azide free
Mouse monoclonal [SPM559] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
SDS-PAGE - Anti-Lambda Light Chain Antibody [N10/2] (A248997) - Antibodies.com
(2)
A248997
Anti-Lambda Light Chain Antibody [N10/2]
Mouse monoclonal [N10/2] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
SDS-PAGE - Anti-Lambda Light Chain Antibody [N10/2] - BSA and Azide free (A252177) - Antibodies.com
(2)
A252177
Anti-Lambda Light Chain Antibody [N10/2] - BSA and Azide free
Mouse monoclonal [N10/2] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [rLLC/1738] (A248999) - Antibodies.com
(3)
A248999
Anti-Lambda Light Chain Antibody [rLLC/1738]
Recombinant mouse monoclonal [rLLC/1738] antibody to Lambda Light Chain for IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [rLLC/1738] - BSA and Azide free (A252179) - Antibodies.com
(3)
A252179
Anti-Lambda Light Chain Antibody [rLLC/1738] - BSA and Azide free
Recombinant mouse monoclonal [rLLC/1738] antibody to Lambda Light Chain for IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [LLC/3774R] - BSA and Azide free (A278589) - Antibodies.com
(3)
A278589
Anti-Lambda Light Chain Antibody [LLC/3774R] - BSA and Azide free
Recombinant rabbit monoclonal [LLC/3774R] antibody to Lambda Light Chain for IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [HP6054] (A248992) - Antibodies.com
(5)
A248992
Anti-Lambda Light Chain Antibody [HP6054]
Mouse monoclonal [HP6054] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [HP6054] - BSA and Azide free (A252172) - Antibodies.com
(5)
A252172
Anti-Lambda Light Chain Antibody [HP6054] - BSA and Azide free
Mouse monoclonal [HP6054] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [LcN-2] - BSA and Azide free (A252173) - Antibodies.com
(4)
A252173
Anti-Lambda Light Chain Antibody [LcN-2] - BSA and Azide free
Mouse monoclonal [LcN-2] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [LcN-2] (A248993) - Antibodies.com
(4)
A248993
Anti-Lambda Light Chain Antibody [LcN-2]
Mouse monoclonal [LcN-2] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [RM127] (A121310) - Antibodies.com
(4)
A121310
Anti-Lambda Light Chain Antibody [RM127]
Recombinant rabbit monoclonal [RM127] antibody to Lambda Light Chain for ICC, IHC, Flow Cytometry and ELISA.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [SPM559] (A248993) - Antibodies.com
(2)
A248994
Anti-Lambda Light Chain Antibody [SPM559]
Mouse monoclonal [SPM559] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [SPM559] - BSA and Azide free (A252173) - Antibodies.com
(2)
A252174
Anti-Lambda Light Chain Antibody [SPM559] - BSA and Azide free
Mouse monoclonal [SPM559] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
SDS-PAGE - Anti-Lambda Light Chain Antibody [N10/2] (A248997) - Antibodies.com
(2)
A248997
Anti-Lambda Light Chain Antibody [N10/2]
Mouse monoclonal [N10/2] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
SDS-PAGE - Anti-Lambda Light Chain Antibody [N10/2] - BSA and Azide free (A252177) - Antibodies.com
(2)
A252177
Anti-Lambda Light Chain Antibody [N10/2] - BSA and Azide free
Mouse monoclonal [N10/2] antibody to Lambda Light Chain for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [rLLC/1738] (A248999) - Antibodies.com
(3)
A248999
Anti-Lambda Light Chain Antibody [rLLC/1738]
Recombinant mouse monoclonal [rLLC/1738] antibody to Lambda Light Chain for IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [rLLC/1738] - BSA and Azide free (A252179) - Antibodies.com
(3)
A252179
Anti-Lambda Light Chain Antibody [rLLC/1738] - BSA and Azide free
Recombinant mouse monoclonal [rLLC/1738] antibody to Lambda Light Chain for IHC-P.
Immunohistochemistry - Anti-Lambda Light Chain Antibody [LLC/3774R] - BSA and Azide free (A278589) - Antibodies.com
(3)
A278589
Anti-Lambda Light Chain Antibody [LLC/3774R] - BSA and Azide free
Recombinant rabbit monoclonal [LLC/3774R] antibody to Lambda Light Chain for IHC-P.
See all Anti-Lambda Light chain Antibodies
Main Menu Contact Us 0Checkout
Top