Anti-MMP20 Antibody (A91891)

Anti-MMP20 Antibody

Rabbit polyclonal antibody to MMP20.

WB: 1:1000-1:2000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 108-310 of human MMP20 (NP_004762.2).

YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGK

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Enamel metalloproteinase, Enamelysin, Matrix metalloproteinase-20, MMP-20