Anti-MSMB Antibody (A92252)

Anti-MSMB Antibody

Rabbit polyclonal antibody to MSMB.

IF: 1:50-1:200

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 21-114 of human MSMB (NP_002434.1).

SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Beta-microseminoprotein, IGBF, Immunoglobulin-binding factor, PN44, Prostate secreted seminal plasma protein, Prostate secretory protein of 94 amino acids, PRSP, PSP-94, PSP94, Seminal plasma beta-inhibin