Anti-NFAT2 Antibody [ARC0076] (A308253)

Anti-NFAT2 Antibody [ARC0076]

Rabbit monoclonal [ARC0076] antibody to NFAT2.

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 844-943 of human NFAT2 (O95644).

PSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS

Rabbit

Monoclonal

ARC0076

IgG

Affinity purification.

110 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

cytoplasmic 1, MGC138448, NF ATc, NF ATc1, NF-ATc, NF-ATc1, NF-ATc1.2, NFAC1_HUMAN, NFAT 2, NFAT transcription complex cytosolic component, NFATc, NFATC 1, NFATc1, Nuclear factor of activated T cells cytoplasmic 1, Nuclear factor of activated T cells cytoplasmic calcineurin dependent 1, Nuclear factor of activated T cells cytosolic component 1, Nuclear factor of activated T-cells, nuclear factor of activated T-cells 'c'