Anti-NSD3 Antibody (A11848)

Anti-NSD3 Antibody

Rabbit polyclonal antibody to NSD3.

WB: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 400-600 of human NSD3/NSD3/WHSC1L1 (NP_060248.2).

EEALSQAKKSVASKTEVKKTRRPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQDRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK

Rabbit

Polyclonal

IgG

Unconjugated

180 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

DKFZp667H044, FLJ20353, Histone lysine N methyltransferase NSD3, Histone-lysine N-methyltransferase NSD3, MGC126766, MGC142029, NSD 3, NSD3_HUMAN, Nuclear set domain containing 3, Nuclear SET domain containing protein 3, Nuclear SET domain-containing protein 3, pp14328, Protein whistle, Whistle, WHSC1 like protein 1, WHSC1-like 1 isoform 9 with methyltransferase activity to lysine, WHSC1-like protein 1, WHSC1L1, WHSC1L1 protein, Wolf Hirschhorn syndrome candidate 1 like 1, Wolf-Hirschhorn syndrome candidate 1-like protein 1