Anti-NUR77 Antibody (A15327)

Anti-NUR77 Antibody

Rabbit polyclonal antibody to NUR77.

WB, IHC

WB: 1:500-1:1,000, IHC: 1:50-1:200

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 300-400 of human NUR77 (NP_002126.2).

KYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDA

Rabbit

Polyclonal

IgG

Unconjugated

64 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Early response protein NAK1, GFRP, GFRP 1, GFRP1, Growth factor inducible nuclear protein N10, Growth Factor Inducible Nuclear Protein NP10, Growth Factor Response Protein 1, Hbr1, HMR, Hormone Receptor, MGC9485, N10, N10 nuclear protein, NAK 1, NAK1, Nerve growth factor IB nuclear receptor variant 1, NGFIB, NP 10, NP10, NR4A1, NR4A1_HUMAN, Nuclear hormone receptor NUR/77, Nuclear Hormone Receptor TR3, Nuclear receptor subfamily 4 group A member 1, NUR77, mouse, homolog of, Orphan nuclear receptor HMR, Orphan nuclear receptor NR4A1, Orphan nuclear receptor TR3, Orphan receptor tr3, Receptor NGFIB, ST 59, ST-59, ST59, Steroid receptor TR3, Testicular receptor 3, TR 3, TR3, TR3 orphan receptor