+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-PCSK9 Antibody [ARC50558] (A80681)

Western Blot - Anti-PCSK9 Antibody [ARC50558] (A80681) - Antibodies.com Western Blot - Anti-PCSK9 Antibody [ARC50558] (A80681) - Antibodies.com
$470
Product Datasheet

Rabbit monoclonal [ARC50558] antibody to PCSK9 for WB.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-PCSK9 Antibody [ARC50558]
Description
Rabbit monoclonal [ARC50558] antibody to PCSK9.
Applications
WB
Dilutions
WB: 1:500-1:1,000
Reactivity
Human
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 593-692 of human Proprotein Convertase 9(PCSK9) (NP_777596.2).
Sequence
EASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC50558
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
65 kDa / 80 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
Convertase subtilisin/kexin type 9 preproprotein, FH3, HCHOLA3, Hypercholesterolemia autosomal dominant 3, LDLCQ1, NARC 1, NARC-1, NARC1, Neural apoptosis regulated convertase 1, Neural apoptosis-regulated convertase 1, PC 9, PC9, PCSK 9, PCSK9_HUMAN, Proprotein convertase 9, Proprotein convertase PC9, Proprotein convertase subtilisin/kexin type 9, PSEC0052, Subtilisin/kexin like protease PC9, Subtilisin/kexin-like protease PC9
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-PCSK9 Antibody [ARC50558] (A80681) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-PCSK9 Antibody [ARC50558] (A80681)
Western blot analysis of extracts of HepG2 cells, using Anti-PCSK9 Antibody [ARC50558] (A80681) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 60s.
Western Blot - Anti-PCSK9 Antibody [ARC50558] (A80681) - Antibodies.comEnlarge Image
Figure 2: Western Blot - Anti-PCSK9 Antibody [ARC50558] (A80681)
Western blot analysis of extracts from wild type(WT) and Proprotein Convertase 9(PCSK9) knockdown (KD) HeLa cells, using Anti-PCSK9 Antibody [ARC50558] (A80681) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 60s.
Publishing research using Anti-PCSK9 Antibody [ARC50558] (A80681)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-PCSK9 Antibody [ARC50558] (A80681)

Western Blot - Anti-PCSK9 Antibody (A84073) - Antibodies.com
(2)
A84073
Anti-PCSK9 Antibody
Goat polyclonal antibody to PCSK9 for ELISA and WB.
Western Blot - Anti-PCSK9 Antibody (A15935) - Antibodies.com
(6)
A15935
Anti-PCSK9 Antibody
Rabbit polyclonal antibody to PCSK9 for WB and ICC/IF.
SDS-PAGE - Alirocumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323273) - Antibodies.com
(3)
A323273
Alirocumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Lodelcizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323553) - Antibodies.com
(2)
A323553
Lodelcizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Recaticimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323693) - Antibodies.com
(2)
A323693
Recaticimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-PCSK9 Antibody [RG7652] - Low endotoxin, Azide free (A324181) - Antibodies.com
(2)
A324181
Anti-PCSK9 Antibody [RG7652] - Low endotoxin, Azide free
Recombinant human monoclonal [RG7652] antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Bococizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323327) - Antibodies.com
(2)
A323327
Bococizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Ebronucimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323406) - Antibodies.com
(2)
A323406
Ebronucimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Evolocumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323441) - Antibodies.com
(2)
A323441
Evolocumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-PCSK9 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324178) - Antibodies.com
(2)
A324178
Anti-PCSK9 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Ongericimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323627) - Antibodies.com
(2)
A323627
Ongericimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Ralpancizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323689) - Antibodies.com
(2)
A323689
Ralpancizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
Western Blot - Anti-PCSK9 Antibody (A84073) - Antibodies.com
(2)
A84073
Anti-PCSK9 Antibody
Goat polyclonal antibody to PCSK9 for ELISA and WB.
Western Blot - Anti-PCSK9 Antibody (A15935) - Antibodies.com
(6)
A15935
Anti-PCSK9 Antibody
Rabbit polyclonal antibody to PCSK9 for WB and ICC/IF.
SDS-PAGE - Alirocumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323273) - Antibodies.com
(3)
A323273
Alirocumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Lodelcizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323553) - Antibodies.com
(2)
A323553
Lodelcizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Recaticimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323693) - Antibodies.com
(2)
A323693
Recaticimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-PCSK9 Antibody [RG7652] - Low endotoxin, Azide free (A324181) - Antibodies.com
(2)
A324181
Anti-PCSK9 Antibody [RG7652] - Low endotoxin, Azide free
Recombinant human monoclonal [RG7652] antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Bococizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323327) - Antibodies.com
(2)
A323327
Bococizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Ebronucimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323406) - Antibodies.com
(2)
A323406
Ebronucimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Evolocumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323441) - Antibodies.com
(2)
A323441
Evolocumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-PCSK9 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324178) - Antibodies.com
(2)
A324178
Anti-PCSK9 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Ongericimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323627) - Antibodies.com
(2)
A323627
Ongericimab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Ralpancizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free (A323689) - Antibodies.com
(2)
A323689
Ralpancizumab Biosimilar - Anti-PCSK9 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PCSK9 for ELISA, FACS, Functional Assay and In Vivo.
See all Anti-PCSK9 Antibodies
Main Menu Contact Us 0Checkout
Top