+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-PD-L1 Antibody (A80578)

Western Blot - Anti-PD-L1 Antibody (A80578) - Antibodies.com Western Blot - Anti-PD-L1 Antibody (A80578) - Antibodies.com Immunohistochemistry - Anti-PD-L1 Antibody (A80578) - Antibodies.com Immunohistochemistry - Anti-PD-L1 Antibody (A80578) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to PD-L1 for WB and IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-PD-L1 Antibody
Description
Rabbit polyclonal antibody to PD-L1.
Applications
WB, IHC
Dilutions
WB: 1:100-1:500, IHC: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-50 of human PD-L1/CD274 (NP_054862.1).
Sequence
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDL
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
40 - 50 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
B7 H, B7 H1, B7 homolog 1, B7-H1, B7H, B7H1, CD 274, CD274, CD274 antigen, CD274 molecule, MGC142294, MGC142296, OTTHUMP00000021029, PD L1, PD1L1_HUMAN, PDCD1 ligand 1, PDCD1L1, PDCD1LG1, PDL 1, PDL1, Programmed cell death 1 ligand 1, Programmed death ligand 1, RGD1566211
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-PD-L1 Antibody (A80578) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-PD-L1 Antibody (A80578)
Western blot analysis of extracts of various cell lines, using Anti-PD-L1 Antibody (A80578) at 1:500 dilution. A-549 cells were treated by IFNG (100 ng/ml) at 37°C for 48 hours. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.
Western Blot - Anti-PD-L1 Antibody (A80578) - Antibodies.comEnlarge Image
Figure 2: Western Blot - Anti-PD-L1 Antibody (A80578)
Western blot analysis of extracts of Mouse skeletal muscle, using Anti-PD-L1 Antibody (A80578) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 180s.
Immunohistochemistry - Anti-PD-L1 Antibody (A80578) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-PD-L1 Antibody (A80578)
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Anti-PD-L1 Antibody (A80578) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-PD-L1 Antibody (A80578) - Antibodies.comEnlarge Image
Figure 4: Immunohistochemistry - Anti-PD-L1 Antibody (A80578)
Immunohistochemistry analysis of paraffin-embedded human placenta using Anti-PD-L1 Antibody (A80578) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Publishing research using Anti-PD-L1 Antibody (A80578)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-PD-L1 Antibody (A80578)

Immunohistochemistry - Anti-PD-L1 Antibody [PDL1/2746] - BSA and Azide free (A251953) - Antibodies.com
(5)
A251953
Anti-PD-L1 Antibody [PDL1/2746] - BSA and Azide free
Mouse monoclonal [PDL1/2746] antibody to PD-L1 for ELISA, WB, Flow Cytometry, IF and IHC-P.
SDS-PAGE - Avelumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323294) - Antibodies.com
(4)
A323294
Avelumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-PD-L1 Antibody [PDL1/2746] (A248773) - Antibodies.com
(5)
A248773
Anti-PD-L1 Antibody [PDL1/2746]
Mouse monoclonal [PDL1/2746] antibody to PD-L1 for ELISA, WB, Flow Cytometry, IF and IHC-P.
SDS-PAGE - Atezolizumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323290) - Antibodies.com
(7)
A323290
Atezolizumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-PD-L1 Antibody [PDL1/4451R] (A248775) - Antibodies.com
(3)
A248775
Anti-PD-L1 Antibody [PDL1/4451R]
Recombinant rabbit monoclonal [PDL1/4451R] antibody to PD-L1 for WB, Flow Cytometry, IF and IHC-P.
SDS-PAGE - Durvalumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323404) - Antibodies.com
(5)
A323404
Durvalumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
Western Blot - Anti-PD-L1 Antibody [ARC5110-01] (A93289) - Antibodies.com
(7)
A93289
Anti-PD-L1 Antibody [ARC5110-01]
Rabbit monoclonal [ARC5110-01] antibody to PD-L1 for WB and IHC.
Western Blot - Anti-CD274 Antibody (A82538) - Antibodies.com
(2)
A82538
Anti-CD274 Antibody
Goat polyclonal antibody to CD274 for ELISA, WB, IF and Flow Cytometry.
SDS-PAGE - Pacmilimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323647) - Antibodies.com
(2)
A323647
Pacmilimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-PD-L1 Antibody [PDL1/4451R] - BSA and Azide free (A251955) - Antibodies.com
(3)
A251955
Anti-PD-L1 Antibody [PDL1/4451R] - BSA and Azide free
Recombinant rabbit monoclonal [PDL1/4451R] antibody to PD-L1 for WB, Flow Cytometry, IF and IHC-P.
SDS-PAGE - Garivulimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323472) - Antibodies.com
(2)
A323472
Garivulimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Sudubrilimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323750) - Antibodies.com
(2)
A323750
Sudubrilimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-PD-L1 Antibody [PDL1/2746] - BSA and Azide free (A251953) - Antibodies.com
(5)
A251953
Anti-PD-L1 Antibody [PDL1/2746] - BSA and Azide free
Mouse monoclonal [PDL1/2746] antibody to PD-L1 for ELISA, WB, Flow Cytometry, IF and IHC-P.
SDS-PAGE - Avelumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323294) - Antibodies.com
(4)
A323294
Avelumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-PD-L1 Antibody [PDL1/2746] (A248773) - Antibodies.com
(5)
A248773
Anti-PD-L1 Antibody [PDL1/2746]
Mouse monoclonal [PDL1/2746] antibody to PD-L1 for ELISA, WB, Flow Cytometry, IF and IHC-P.
SDS-PAGE - Atezolizumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323290) - Antibodies.com
(7)
A323290
Atezolizumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-PD-L1 Antibody [PDL1/4451R] (A248775) - Antibodies.com
(3)
A248775
Anti-PD-L1 Antibody [PDL1/4451R]
Recombinant rabbit monoclonal [PDL1/4451R] antibody to PD-L1 for WB, Flow Cytometry, IF and IHC-P.
SDS-PAGE - Durvalumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323404) - Antibodies.com
(5)
A323404
Durvalumab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
Western Blot - Anti-PD-L1 Antibody [ARC5110-01] (A93289) - Antibodies.com
(7)
A93289
Anti-PD-L1 Antibody [ARC5110-01]
Rabbit monoclonal [ARC5110-01] antibody to PD-L1 for WB and IHC.
Western Blot - Anti-CD274 Antibody (A82538) - Antibodies.com
(2)
A82538
Anti-CD274 Antibody
Goat polyclonal antibody to CD274 for ELISA, WB, IF and Flow Cytometry.
SDS-PAGE - Pacmilimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323647) - Antibodies.com
(2)
A323647
Pacmilimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-PD-L1 Antibody [PDL1/4451R] - BSA and Azide free (A251955) - Antibodies.com
(3)
A251955
Anti-PD-L1 Antibody [PDL1/4451R] - BSA and Azide free
Recombinant rabbit monoclonal [PDL1/4451R] antibody to PD-L1 for WB, Flow Cytometry, IF and IHC-P.
SDS-PAGE - Garivulimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323472) - Antibodies.com
(2)
A323472
Garivulimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Sudubrilimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free (A323750) - Antibodies.com
(2)
A323750
Sudubrilimab Biosimilar - Anti-PD-L1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to PD-L1 for ELISA, FACS, Functional Assay and In Vivo.
See all Anti-PD-L1 Antibodies
Main Menu Contact Us 0Checkout
Top