Anti-PIAS1 Antibody [ARC1116] (A305639)

Anti-PIAS1 Antibody [ARC1116]

Rabbit monoclonal [ARC1116] antibody to PIAS1.

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 3-101 of human PIAS1 (O75925).

DSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDG

Rabbit

Monoclonal

ARC1116

IgG

Affinity purification.

76 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AR interacting protein, DDXBP1, DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1, DEAD/H box binding protein 1, DEAD/H box-binding protein 1, E3 SUMO-protein ligase PIAS1, GBP, Gu binding protein, Gu-binding protein, GU/RH-II, PIAS1_HUMAN, Protein inhibitor of activated STAT protein 1, Protein inhibitor of activated STAT, 1, RNA helicase II binding protein, RNA helicase II-binding protein, Zinc finger, MIZ-type containing 3, ZMIZ3