Anti-POLR3K Antibody (A9882)

Anti-POLR3K Antibody

Rabbit polyclonal antibody to POLR3K.

WB: 1:500-1:2000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human POLR3K (NP_057394.3).

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

Rabbit

Polyclonal

IgG

Unconjugated

12kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C11, C11 RNP3, DNA directed RNA polymerase III subunit K, DNA directed RNA polymerase III subunit RPC10, DNA directed RNA polymerases III 12.5 kDa polypeptide, DNA-directed RNA polymerase III subunit K, DNA-directed RNA polymerase III subunit RPC10, hRPC11, HsC11p, My010, Polymerase (RNA) III (DNA directed) polypeptide K, Polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa, RNA polymerase III 12.5 kDa subunit, RNA polymerase III subunit (hRPC11), RNA polymerase III subunit C10, RNA polymerase III subunit C11, RNA polymerase III subunit CII, RPC10, RPC10_HUMAN, RPC11, RPC12.5