Anti-RELM beta Antibody (A92701)

Anti-RELM beta Antibody

Rabbit polyclonal antibody to RELM beta.

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human RETNLB (NP_115968.1).

MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

Rabbit

Polyclonal

IgG

Unconjugated

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 2, CCGR, Colon and small intestine specific cysteine rich protein, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma related gene protein, Colon carcinoma-related gene protein, Cysteine rich secreted A12 alpha like protein 1, Cysteine rich secreted protein A12 alpha like 1, Cysteine rich secreted protein FIZZ2, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, FIZZ1, FIZZ2, Found in inflammatory zone 1, HXCP2, RELMb, RELMbeta, Resistin like beta, Resistin like protein beta, Resistin-like beta, RETNB_HUMAN, RETNL2, Retnlb, XCP2