Anti-RHBDD1 Antibody (A92246)

Anti-RHBDD1 Antibody

Rabbit polyclonal antibody to RHBDD1.

WB: 1:500-1:2000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 206-315 of human RHBDD1 (NP_115652.2).

TQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

RHBDL4, Rhomboid domain-containing protein 1, Rhomboid-like protein 4, Rhomboid-related protein 4, RRP4