+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-S100 beta Antibody (A17137)

Western Blot - Anti-S100 beta Antibody (A17137) - Antibodies.com Immunohistochemistry - Anti-S100 beta Antibody (A17137) - Antibodies.com Immunofluorescence - Anti-S100 beta Antibody (A17137) - Antibodies.com Western Blot - Anti-S100 beta Antibody (A17137) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to S100 beta for WB, IHC, ICC/IF and IP.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-S100 beta Antibody
Description
Rabbit polyclonal antibody to S100 beta.
Applications
WB, IHC, ICC/IF, IP
Dilutions
WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:100-1:500
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100B (NP_006263.1).
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
11 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
NEF, Protein S100 B, Protein S100-B, S 100 calcium binding protein beta chain, S 100 protein beta chain, S-100 protein beta chain, S-100 protein subunit beta, S100, S100 calcium binding protein beta (neural), S100 calcium-binding protein B, S100 protein beta chain, S100B, S100beta, S100B_HUMAN
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-S100 beta Antibody (A17137) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-S100 beta Antibody (A17137)
Western blot analysis of extracts of various cell lines, using Anti-S100 beta Antibody (A17137) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 180s.
Immunohistochemistry - Anti-S100 beta Antibody (A17137) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-S100 beta Antibody (A17137)
Immunohistochemistry analysis of paraffin-embedded mouse brain using Anti-S100 beta Antibody (A17137) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence - Anti-S100 beta Antibody (A17137) - Antibodies.comEnlarge Image
Figure 3: Immunofluorescence - Anti-S100 beta Antibody (A17137)
Immunofluorescence analysis of U-251 MG cells using Anti-S100 beta Antibody (A17137) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).
Western Blot - Anti-S100 beta Antibody (A17137) - Antibodies.comEnlarge Image
Figure 4: Western Blot - Anti-S100 beta Antibody (A17137)
Immunoprecipitation analysis of 600µg extracts of mouse brain cells using 3µg of Anti-S100 beta Antibody (A17137). This Western blot was performed on the immunoprecipitate using Anti-S100 beta Antibody (A17137) at a dilution of 1:500.
Publishing research using Anti-S100 beta Antibody (A17137)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-S100 beta Antibody (A17137)

Immunohistochemistry - Anti-S100 beta Antibody [S100B/1012] - BSA and Azide free (A253116) - Antibodies.com
(6)
A253116
Anti-S100 beta Antibody [S100B/1012] - BSA and Azide free
Mouse monoclonal [S100B/1012] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [S100B/1012] (A249936) - Antibodies.com
(6)
A249936
Anti-S100 beta Antibody [S100B/1012]
Mouse monoclonal [S100B/1012] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [4C4.9] (A249934) - Antibodies.com
(5)
A249934
Anti-S100 beta Antibody [4C4.9]
Mouse monoclonal [4C49] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [4C4.9] - BSA and Azide free (A253114) - Antibodies.com
(5)
A253114
Anti-S100 beta Antibody [4C4.9] - BSA and Azide free
Mouse monoclonal [4C49] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [rS100B/1896] (A249938) - Antibodies.com
(5)
A249938
Anti-S100 beta Antibody [rS100B/1896]
Recombinant mouse monoclonal [rS100B/1896] antibody to S100 beta for WB and IHC-P.
SDS-PAGE - Anti-S100 beta Antibody [S100B/4153] - BSA and Azide free (A278371) - Antibodies.com
(4)
A278371
Anti-S100 beta Antibody [S100B/4153] - BSA and Azide free
Mouse monoclonal [S100B/4153] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
SDS-PAGE - Anti-S100 beta Antibody [S100B/4153] (A277783) - Antibodies.com
(4)
A277783
Anti-S100 beta Antibody [S100B/4153]
Mouse monoclonal [S100B/4153] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [S100B/1706R] - BSA and Azide free (A253120) - Antibodies.com
(4)
A253120
Anti-S100 beta Antibody [S100B/1706R] - BSA and Azide free
Recombinant rabbit monoclonal [S100B/1706R] antibody to S100 beta for WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [rS100B/1896] - BSA and Azide free (A253118) - Antibodies.com
(5)
A253118
Anti-S100 beta Antibody [rS100B/1896] - BSA and Azide free
Recombinant mouse monoclonal [rS100B/1896] antibody to S100 beta for WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [4C4.9 + S100B/1012] (A249937) - Antibodies.com
(3)
A249937
Anti-S100 beta Antibody [4C4.9 + S100B/1012]
Mouse monoclonal [4C49 + S100B/1012] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [4C4.9 + S100B/1012] - BSA and Azide free (A253117) - Antibodies.com
(3)
A253117
Anti-S100 beta Antibody [4C4.9 + S100B/1012] - BSA and Azide free
Mouse monoclonal [4C49 + S100B/1012] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [SPM354] - BSA and Azide free (A253114) - Antibodies.com
(3)
A253115
Anti-S100 beta Antibody [SPM354] - BSA and Azide free
Mouse monoclonal [SPM354] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [S100B/1012] - BSA and Azide free (A253116) - Antibodies.com
(6)
A253116
Anti-S100 beta Antibody [S100B/1012] - BSA and Azide free
Mouse monoclonal [S100B/1012] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [S100B/1012] (A249936) - Antibodies.com
(6)
A249936
Anti-S100 beta Antibody [S100B/1012]
Mouse monoclonal [S100B/1012] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [4C4.9] (A249934) - Antibodies.com
(5)
A249934
Anti-S100 beta Antibody [4C4.9]
Mouse monoclonal [4C49] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [4C4.9] - BSA and Azide free (A253114) - Antibodies.com
(5)
A253114
Anti-S100 beta Antibody [4C4.9] - BSA and Azide free
Mouse monoclonal [4C49] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [rS100B/1896] (A249938) - Antibodies.com
(5)
A249938
Anti-S100 beta Antibody [rS100B/1896]
Recombinant mouse monoclonal [rS100B/1896] antibody to S100 beta for WB and IHC-P.
SDS-PAGE - Anti-S100 beta Antibody [S100B/4153] - BSA and Azide free (A278371) - Antibodies.com
(4)
A278371
Anti-S100 beta Antibody [S100B/4153] - BSA and Azide free
Mouse monoclonal [S100B/4153] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
SDS-PAGE - Anti-S100 beta Antibody [S100B/4153] (A277783) - Antibodies.com
(4)
A277783
Anti-S100 beta Antibody [S100B/4153]
Mouse monoclonal [S100B/4153] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [S100B/1706R] - BSA and Azide free (A253120) - Antibodies.com
(4)
A253120
Anti-S100 beta Antibody [S100B/1706R] - BSA and Azide free
Recombinant rabbit monoclonal [S100B/1706R] antibody to S100 beta for WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [rS100B/1896] - BSA and Azide free (A253118) - Antibodies.com
(5)
A253118
Anti-S100 beta Antibody [rS100B/1896] - BSA and Azide free
Recombinant mouse monoclonal [rS100B/1896] antibody to S100 beta for WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [4C4.9 + S100B/1012] (A249937) - Antibodies.com
(3)
A249937
Anti-S100 beta Antibody [4C4.9 + S100B/1012]
Mouse monoclonal [4C49 + S100B/1012] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [4C4.9 + S100B/1012] - BSA and Azide free (A253117) - Antibodies.com
(3)
A253117
Anti-S100 beta Antibody [4C4.9 + S100B/1012] - BSA and Azide free
Mouse monoclonal [4C49 + S100B/1012] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-S100 beta Antibody [SPM354] - BSA and Azide free (A253114) - Antibodies.com
(3)
A253115
Anti-S100 beta Antibody [SPM354] - BSA and Azide free
Mouse monoclonal [SPM354] antibody to S100 beta for Flow Cytometry, IF, WB and IHC-P.
See all Anti-S100 beta Antibodies
Main Menu Contact Us 0Checkout
Top