Anti-Serglycin Antibody (A88831)

Anti-Serglycin Antibody

Rabbit polyclonal antibody to Serglycin.

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 28-158 of human SRGN (NP_002718.2).

YPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML

Rabbit

Polyclonal

IgG

Unconjugated

23 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Chondroitin sulfate proteoglycan core protein, Cytolytic granule proteoglycan core protein, FLJ12930, gp600, Hematopoetic proteoglycan core protein, Mastocytoma proteoglycan core protein, MGC9289, OTTHUMP00000019716, P.PG, PG19 core protein, Pgsg, Platelet proteoglycan core protein, platelet proteoglycan protein core, PLATELET PROTEOGLYCAN PROTEIN CORE; PPG, PPG, PRG, PRG1, PROTEOGLYCAN 1, proteoglycan 1, secretory granule, Proteoglycan 10K core protein, Proteoglycan peptide core protein, PROTEOGLYCAN PROTEIN CORE FOR MAST CELL SECRETORY GRANULE, secretory granule proteoglycan 1, Secretory granule proteoglycan core peptide, Secretory granule proteoglycan core protein, serglycin proteoglycan, Sgc, Srgn, SRGN_HUMAN