Anti-SIGLEC10 Antibody (A305953)

Anti-SIGLEC10 Antibody

Rabbit polyclonal antibody to SIGLEC10.

WB: 1:500-1:1,000

Human, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 627-697 of human SIGLEC10 (NP_149121.2).

GAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKFQ

Rabbit

Polyclonal

IgG

Unconjugated

100 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

mSiglec G, PRO940, Sialic acid binding Ig like lectin 10, sialic acid binding Ig like lectin 10 Ig like lectin 7, sialic acid binding Ig like lectin G, Sialic acid binding Immunoglobulin like lectin 10, Sialic acid-binding Ig-like lectin 10, SIG10_HUMAN, SIGLEC 10, Siglec G, siglec like gene 2, Siglec like protein 2, Siglec-10, Siglec-like protein 2, Siglecg, SLG2