Anti-SLC40A1 Antibody (A91593)

Anti-SLC40A1 Antibody

Rabbit polyclonal antibody to SLC40A1.

WB: 1:100-1:500

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC40A1 (NP_055400.1).

SPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWV

Rabbit

Polyclonal

IgG

Unconjugated

63 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Ferroportin, Ferroportin 1, Ferroportin-1, FPN1, HFE4, IREG1, iron regulated gene 1, Iron regulated transporter 1, Iron-regulated transporter 1, MST079, MSTP079, MTP1, putative ferroportin 1 variant IIIA, putative ferroportin 1 variant IIIB, S40A1_HUMAN, SLC11A3, SLC11A3, formerly, solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3, solute carrier family 11 (proton-coupled divalent metal ion transporters), member 3, formerly, solute carrier family 40 (iron-regulated transporter), member 1, Solute carrier family 40 member 1