Anti-SNAPC1 Antibody (A87663)

Anti-SNAPC1 Antibody

Rabbit polyclonal antibody to SNAPC1.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human SNAPC1 (NP_003073.1).

MGTPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLEKNMFTKEALALAWRYFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKPDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH

Rabbit

Polyclonal

IgG

Unconjugated

50 - 55 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Proximal sequence element-binding transcription factor subunit gamma, PSE binding factor subunit gamma, PSE-binding factor subunit gamma, PTF subunit gamma, PTFgamma, Small nuclear RNA activating complex polypeptide 1, small nuclear RNA activating complex, polypeptide 1, 43kDa, Small nuclear RNA-activating complex polypeptide 1, Small nuclear RNA-activating protein complex, 43-KD subunit, SNAP43, SNAPc 43 kDa subunit, SNAPc subunit 1, SNPC1_HUMAN, snRNA activating protein complex 43 kDa subunit, snRNA activating protein complex subunit 1, snRNA-activating protein complex 43 kDa subunit, snRNA-activating protein complex subunit 1