Anti-SRRM2 Antibody (A91558)

Anti-SRRM2 Antibody

Rabbit polyclonal antibody to SRRM2.

WB: 1:500-1:2000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRRM2 (NP_057417.3).

MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLE

Rabbit

Polyclonal

IgG

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

300 kDa nuclear matrix antigen, KIAA0324, Ser/Arg-related nuclear matrix protein of 300 kDa, Serine/arginine repetitive matrix protein 2, Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa, Splicing coactivator subunit SRm300, SR-related nuclear matrix protein of 300 kDa, SRL300, SRM300, Tax-responsive enhancer element-binding protein 803, TaxREB803