TFF1 Human (A61793)

TFF1 Human

Trefoil Factor-1 Human Recombinant

Escherichia Coli.

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF.

Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

The protein was lyophilized after dialysis against 1xPBS pH-7.4.

Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

BCEI, Breast cancer estrogen inducible protein, Breast cancer estrogen inducible sequence, Breast cancer estrogen-inducible protein, D21S21, Estrogen Inducible Protein pS2, Gastrointestinal trefoil protein, Gastrointestinal trefoil protein pS2, hP1.A, HP1A, HPS 2, HPS2, pNR 2, PNR-2, pNR2, Polypeptide P1.A, Protein pS2, PS 2, pS2, pS2 protein, TFF 1, TFF1_HUMAN, Trefoil factor 1