Anti-TRIF Antibody (A92232)

Anti-TRIF Antibody

Rabbit polyclonal antibody to TRIF.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human TRIF/TICAM1 (NP_891549.1).

QDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPRPIDGVSDWSQGCSLRSTGSP

Rabbit

Polyclonal

IgG

Unconjugated

70 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

IIAE6, MGC35334, MyD88 3, Proline rich vinculin and TIR domain containing protein B, Proline-rich, PRVTIRB, Putative NF kappa B activating protein 502H, Putative NF-kappa-B-activating protein 502H, Putative NFkB activating protein, TCAM1_HUMAN, TICAM 1, TICAM-1, Ticam1, TIR domain containing adapter molecule 1, TIR domain containing adapter protein inducing IFN beta, TIR domain containing adaptor inducing interferon beta, TIR domain-containing adapter molecule 1, TIR domain-containing adapter protein inducing IFN-beta, Toll interleukin 1 receptor domain containing adapter protein inducing interferon beta, Toll like receptor adaptor molecule 1, Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta, TRIF protein, vinculin and TIR domain-containing protein B