Anti-TRPV4 Antibody (A14888)

Anti-TRPV4 Antibody

Rabbit polyclonal antibody to TRPV4.

WB: 1:500-1:1,000

Human

A synthetic peptide corresponding to a sequence within amino acids 772-871 of human TRPV4 (NP_067638.3).

PDRRWCFRVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDEVVVPLDSMGNPRCDGHQQGYPRKWRTDDAPL

Rabbit

Polyclonal

IgG

Unconjugated

95 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

BCYM3, CMT2C, HMSN2C, osm 9 like TRP channel 4, Osm-9-like TRP channel 4, OSM9 like transient receptor potential channel 4, Osmosensitive transient receptor potential channel 4, OTRPC 4, OTRPC4, SMAL, SPSMA, SSQTL1, Transient receptor potential cation channel subfamily V member 4, Transient receptor potential protein 12, TRP 12, TRP12, TRPV 4, TRPV4_HUMAN, Vanilloid receptor like channel 2, Vanilloid receptor like protein 2, Vanilloid receptor related osmotically activated channel, Vanilloid receptor-like channel 2, Vanilloid receptor-like protein 2, Vanilloid receptor-related osmotically-activated channel, VR 4, VR OAC, VR-OAC, VR4, VRL 2, VRL-2, VRL2, VROAC