Anti-TXNDC4 Antibody (A87649)

Anti-TXNDC4 Antibody

Rabbit polyclonal antibody to TXNDC4.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 57-406 of human ERP44 (NP_055866.1).

WCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL

Rabbit

Polyclonal

IgG

Affinity purification.

40 - 48 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Endoplasmic reticulum resident protein 44, Endoplasmic reticulum resident protein 44 kDa, Endoplasmic reticulum resident protein ERp44, ER protein 44, ERp44, ERP44_HUMAN, KIAA0573, PDIA10, Protein disulfide isomerase family A, member 10, Thioredoxin domain containing 4 (endoplasmic reticulum), Thioredoxin domain containing protein 4, Thioredoxin domain-containing protein 4, UNQ532/PRO1075