Anti-UBE2D3 Antibody (A88279)

Anti-UBE2D3 Antibody

Rabbit polyclonal antibody to UBE2D3.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2D3 (NP_003331.1).

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTIS

Rabbit

Polyclonal

IgG

Unconjugated

14 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

E2(17)KB3, MGC43926, MGC5416, PRO2116, UB2D3_HUMAN, UBC 4/5, UBC4/5, UBC4/5 homolog yeast, UBC4/5, S. cerevisiae, homolog of, UBCH 5C, UBCH5C, Ubiquitin carrier protein, Ubiquitin carrier protein D3, Ubiquitin conjugating enzyme E2 17 kDa 3, Ubiquitin conjugating enzyme E2 D3, Ubiquitin conjugating enzyme E2D 3, Ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5), Ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog yeast), Ubiquitin protein ligase D3, Ubiquitin-conjugating enzyme E2 D3, Ubiquitin-conjugating enzyme E2(17)KB 3, Ubiquitin-conjugating enzyme E2-17 kDa 3, Ubiquitin-protein ligase D3