VEGF (121 a.a.) Human, Sf9 (A63066)

VEGF (121 a.a.) Human, Sf9

Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant, Sf9

Sf9, Insect Cells.

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR.

Sterile Filtered White lyophilized (freeze-dried) powder.

The protein was lyophilized from a solution containing 50mM acetic acid.

Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

This product is for research use only. It is not intended for diagnostic or therapeutic use.