Anti-WSTF Antibody [ARC1614] (A306961)

Anti-WSTF Antibody [ARC1614]

Rabbit monoclonal [ARC1614] antibody to WSTF.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WSTF (Q9UIG0).

MAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLE

Rabbit

Monoclonal

ARC1614

IgG

Affinity purification.

185 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

baz1b, BAZ1B_HUMAN, Bromodomain adjacent to zinc finger domain protein 1B, hWALP 2, hWALP-2, hWALP2, transcription factor WSTF, Tyrosine-protein kinase BAZ1B, WALP-2, WALP2, WBRS 9, WBRS-9, WBRS9, WBSC 10, WBSC-10, WBSC10, WBSCR10, WBSCR9, Williams Beuren syndrome chromosome region 9 protein, Williams syndrome transcription factor, Williams-Beuren syndrome chromosomal region 10 protein, Williams-Beuren syndrome chromosomal region 9 protein