Anti-XPG Antibody (A13542)

Anti-XPG Antibody

Rabbit polyclonal antibody to XPG.

ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human ERCC5 (NP_000114.2).

MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSIENPHLLTLFHRLCKLLFFRIRPIFVFDGDAPLLKKQTLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIKTAFRSKRDEALPSLTQVRRENDLYVLPPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFFHNPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEG

Rabbit

Polyclonal

IgG

Unconjugated

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

COFS 3, COFS3, DNA excision repair protein ERCC 5, DNA excision repair protein ERCC-5, DNA excision repair protein ERCC5, DNA repair protein complementing XP G cells, DNA repair protein complementing XP-G cells, DNA repair protein complementing XPG cells, ERCC 5, ERCC5, ERCC5_HUMAN, ERCM 2, ERCM2, Excision repair cross complementation group 5, Excision Repair Cross Complementing Rodent Repair Deficiency, Excision repair cross complementing rodent repair deficiency complementation group 5, Excision repair protein, OTTHUMP00000064902, UVDR, Xeroderma Pigmentosum Complementation Group G, Xeroderma pigmentosum complementation group G protein, Xeroderma pigmentosum group G complementing protein, Xeroderma pigmentosum group G-complementing protein, XPG complementing protein, XPGC