Anti-ZEB1 Antibody [ARC53599] (A306318)

Anti-ZEB1 Antibody [ARC53599]

Rabbit monoclonal [ARC53599] antibody to ZEB1.

WB: 1:1,000-1:5,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 800-900 of human ZEB1 (NP_110378.3).

INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE

Rabbit

Monoclonal

ARC53599

IgG

Unconjugated

200 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AREB 6, AREB6, BZP, Delta crystallin enhancer binding factor 1, DELTA EF1, FECD6, MGC133261, Negative regulator of IL 2, Negative regulator of IL2, NIL 2 A, NIL 2 A zinc finger protein, NIL 2A, NIL-2-A zinc finger protein, NIL2A, Posterior polymorphous corneal dystrophy 3, PPCD3, Represses interleukin 2 expression, TCF 8, TCF-8, TCF8, Transcription factor 8, Transcription factor 8 (represses interleukin 2 expression), ZEB, ZEB 1, ZEB1_HUMAN, ZFHEP, ZFHX 1A, ZFHX1A, Zinc finger E box binding homeobox 1, Zinc finger E-box-binding homeobox 1, Zinc finger homeodomain enhancer binding protein