Anti-ATF-4 Antibody (A92546)

Anti-ATF-4 Antibody

Rabbit polyclonal antibody to ATF-4.

IHC: 1:50-1:100

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ATF4 (NP_001666.2).

MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAY

Rabbit

Polyclonal

IgG

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Activating transcription factor 4, ATF 4, ATF4, ATF4 protein, ATF4_HUMAN, cAMP-dependent transcription factor ATF-4, cAMP-responsive element-binding protein 2, CREB 2, CREB-2, CREB2, Cyclic AMP dependent transcription factor ATF 4, Cyclic AMP response element binding protein 2, Cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2, DNA binding protein TAXREB67, DNA-binding protein TAXREB67, Tax Responsive Enhancer Element B67, Tax-responsive enhancer element-binding protein 67, TaxREB67, TXREB