Anti-IL-21 Antibody (A283234)

Anti-IL-21 Antibody

Goat polyclonal antibody to IL-21.

This antibody recognises human interleukin-21, also known as IL-21 or Za11. IL-21 is a , a 155 amino acid pro-cytokine, reduced to 133 anino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence atthe C-terminus (UniProt: Q9HBE4). recognises an epitope within the N-terminal region of human interleukin-21 (IL-21) and is expected to bind both isoforms.IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway.Goat anti Human Interleukin-21 antibody is suitable for use in immunocytochemistry on human spleen or tonsil cells.

IHC-P, ELISA, ICC

ELISA: 1:50,000

Human

Synthetic peptide sequence C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminus of human IL-21.

C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE

Goat

Polyclonal

IgG

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 0.1% BSA and 0.1% Sodium Azide.

Store undiluted at -20°C only. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Goat anti Human Interleukin-21 antibody recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a , a 155 amino acid pro-cytokine, reduced to 133 anino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence atthe C-terminus (UniProt: Q9HBE4). Goat anti Human interleukin-21 antibody recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms.IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway.Goat anti Human Interleukin-21 antibody is suitable for use in immunocytochemistry on human spleen or tonsil cells.

IL21, Interleukin-21, Za11