Anti-IL-32 Antibody [B08-3A9] (A279735)

Anti-IL-32 Antibody [B08-3A9]

Mouse monoclonal [B08-3A9] antibody to IL-32.

This antibody recognises human IL-32, a 26 kDa cytokine. There are four known isoforms of IL-32, IL-32a, ß d and ?. IL-32 activates NF-kappa-B and p38 MAPK cytokine signaling pathways. IL-32 has a pro-inflammatory role in innate and adaptive immune responses and is produced by mitogen-activated lymphocytes, IFN gamma-activated epithelial cells and IL-12, IL-18, IL-32-activated NK cells. IL-32 is expressed at elevated levels after the activation of T-cells by mitogens or the activation of NK cells by IL-2. Among its other effects in innate immunity are the induction of the crucial inflammatory cytokines TNFa and IL-6. and it shows elevated levels of expression in various inflammatory autoimmune diseases, certain cancers, as well as viral infections (Kim, 2014).

WB, ELISA

WB: 1:1,000

Human

E. coli derived recombinant protein corresponding to amino acids 2-131 of human IL-32 alpha.

CFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGN

Mouse

Monoclonal

B08-3A9

IgG1

Protein G affinity chromatography of ascites.

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human Interleukin-32, clone B08-3A9, recognizes human IL-32, a 26 kDa cytokine. There are four known isoforms of IL-32, IL-32a, ß d and ?. IL-32 activates NF-kappa-B and p38 MAPK cytokine signaling pathways. IL-32 has a pro-inflammatory role in innate and adaptive immune responses and is produced by mitogen-activated lymphocytes, IFN gamma-activated epithelial cells and IL-12, IL-18, IL-32-activated NK cells. IL-32 is expressed at elevated levels after the activation of T-cells by mitogens or the activation of NK cells by IL-2. Among its other effects in innate immunity are the induction of the crucial inflammatory cytokines TNFa and IL-6. and it shows elevated levels of expression in various inflammatory autoimmune diseases, certain cancers, as well as viral infections (Kim, 2014).

IL32, Interleukin-32, Natural killer cells protein 4, NK4, TAIF, Tumor necrosis factor alpha-inducing factor