Anti-MAP4K3 Antibody (A92495)

Anti-MAP4K3 Antibody

Rabbit polyclonal antibody to MAP4K3.

IF: 1:50-1:200

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 755-894 of human MAP4K3 (NP_003609.2).

ETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Germinal center kinase-related protein kinase, GLK, MAPK/ERK kinase kinase kinase 3, MEK kinase kinase 3, MEKKK 3, Mitogen-activated protein kinase kinase kinase kinase 3, RAB8IPL1