Anti-SCN8A Antibody (A8502)

Anti-SCN8A Antibody

Rabbit polyclonal antibody to SCN8A.

WB: 1:200-1:1000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 1350-1440 of human SCN8A (NP_055006.1).

AGKYHYCFNETSEIRFEIEDVNNKTECEKLMEGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPKYEDNIYM

Rabbit

Polyclonal

IgG

165kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

HBA, HBSC II, hNaN, KIAA1356, MED, NAC2, NAC3, Peripheral nerve sodium channel 5, PN5, SCN11A, SCN12A, SCN2A, SCN2A1, SCN2A2, SCN3A, Sensory neuron sodium channel 2, SNS2, Sodium channel protein brain II subunit alpha, Sodium channel protein brain III subunit alpha, Sodium channel protein type 11 subunit alpha, Sodium channel protein type 2 subunit alpha, Sodium channel protein type 3 subunit alpha, Sodium channel protein type 8 subunit alpha, Sodium channel protein type II subunit alpha, Sodium channel protein type III subunit alpha, Sodium channel protein type VIII subunit alpha, Sodium channel protein type XI subunit alpha, Voltage-gated sodium channel subtype III, Voltage-gated sodium channel subunit alpha Nav1.2, Voltage-gated sodium channel subunit alpha Nav1.3, Voltage-gated sodium channel subunit alpha Nav1.6, Voltage-gated sodium channel subunit alpha Nav1.9