+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-CD36 Antibody (A91438)

Western Blot - Anti-CD36 Antibody (A91438) - Antibodies.com Immunohistochemistry - Anti-CD36 Antibody (A91438) - Antibodies.com Immunohistochemistry - Anti-CD36 Antibody (A91438) - Antibodies.com Immunohistochemistry - Anti-CD36 Antibody (A91438) - Antibodies.com
This product is discontinued

Anti-CD36 Antibody (A91438) has been discontinued and is no longer available.

View all Anti-CD36 Antibodies.

Name
Anti-CD36 Antibody
Description
Rabbit polyclonal antibody to CD36.
Applications
WB, IHC
Dilutions
WB: 1:500-1:1,000, IHC: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD36/SR-B3 (NP_000063.2).
Sequence
AFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQ
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
70 - 110 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
Adipocyte membrane protein, BDPLT10, CD36 antigen, CD36 antigen (collagen type I receptor, thrombospondin receptor), CD36 molecule, CD36 molecule (thrombospondin receptor), CD36_HUMAN, CHDS7, Cluster determinant 36, Collagen receptor, platelet, FAT, Fatty acid translocase, Fatty acid transport protein, Glycoprotein IIIb, GP IIIb, GP3B, GP4, GPIIIB, GPIV, Leukocyte differentiation antigen CD36, MGC108510, MGC91634, PAS 4 protein, PAS IV, PAS-4, PASIV, Platelet collagen receptor, Platelet glycoprotein 4, Platelet glycoprotein IV, scarb3, Scavenger receptor class B member 3, Thrombospondin receptor
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-CD36 Antibody (A91438) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-CD36 Antibody (A91438)
Western blot analysis of extracts of various cell lines, using Anti-CD36 Antibody (A91438) at 1:1,000 dilution. THP-1 cells were treated by PMA/TPA (200 nM) at 37°C for 15 minutes after serum-starvation overnight. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry - Anti-CD36 Antibody (A91438) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-CD36 Antibody (A91438)
Immunohistochemistry analysis of paraffin-embedded human liver using Anti-CD36 Antibody (A91438) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-CD36 Antibody (A91438) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-CD36 Antibody (A91438)
Immunohistochemistry analysis of paraffin-embedded mouse liver using Anti-CD36 Antibody (A91438) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-CD36 Antibody (A91438) - Antibodies.comEnlarge Image
Figure 4: Immunohistochemistry - Anti-CD36 Antibody (A91438)
Immunohistochemistry analysis of paraffin-embedded rat spleen using Anti-CD36 Antibody (A91438) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Publishing research using Anti-CD36 Antibody (A91438)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-CD36 Antibody (A91438)

SDS-PAGE - Anti-CD36 Antibody [185-1G2] (A250685) - Antibodies.com
A250686
Anti-CD36 Antibody [185-1G2]
Mouse monoclonal [185-1G2] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
Western Blot - Anti-CD36 Antibody [CD36/7217] - BSA and Azide free (A278442) - Antibodies.com
(2)
A278442
Anti-CD36 Antibody [CD36/7217] - BSA and Azide free
Mouse monoclonal [CD36/7217] antibody to CD36 for Functional Studies, WB and IHC-P.
Western Blot - Anti-CD36 Antibody (C30346) - Antibodies.com
(2)
A98246
Anti-CD36 Antibody
Rabbit polyclonal antibody to CD36 for WB and ELISA.
Western Blot - Anti-CD36 Antibody [CD36/7217] (A277854) - Antibodies.com
(2)
A277854
Anti-CD36 Antibody [CD36/7217]
Mouse monoclonal [CD36/7217] antibody to CD36 for Functional Studies, WB and IHC-P.
SDS-PAGE - Anti-CD36 Antibody [185-1G2] - BSA and Azide free (A253865) - Antibodies.com
A253866
Anti-CD36 Antibody [185-1G2] - BSA and Azide free
Mouse monoclonal [185-1G2] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-CD36 Antibody [1A7] (A250686) - Antibodies.com
A250687
Anti-CD36 Antibody [1A7]
Mouse monoclonal [1A7] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-CD36 Antibody [1A7] - BSA and Azide free (A253866) - Antibodies.com
A253867
Anti-CD36 Antibody [1A7] - BSA and Azide free
Mouse monoclonal [1A7] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-CD36 Antibody [1E8] (A250687) - Antibodies.com
A250688
Anti-CD36 Antibody [1E8]
Mouse monoclonal [1E8] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-CD36 Antibody [1E8] - BSA and Azide free (A253867) - Antibodies.com
A253868
Anti-CD36 Antibody [1E8] - BSA and Azide free
Mouse monoclonal [1E8] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-CD36 Antibody [GPIIIb/1654] - BSA and Azide free (A253868) - Antibodies.com
A253869
Anti-CD36 Antibody [GPIIIb/1654] - BSA and Azide free
Mouse monoclonal [GPIIIb/1654] antibody to CD36 for Flow Cytometry and IF.
Antibodies.com Image Placeholder - Discover more for less
A281186
Anti-CD36 Antibody [MF3]
Rat monoclonal [MF3] antibody to CD36 for WB, IF and Flow Cytometry.
Antibodies.com Image Placeholder - Discover more for less
A281187
Anti-CD36 Antibody [MF3] - BSA and Azide free
Rat monoclonal [MF3] antibody to CD36 for IF, Flow Cytometry and Functional Assays.
SDS-PAGE - Anti-CD36 Antibody [185-1G2] (A250685) - Antibodies.com
A250686
Anti-CD36 Antibody [185-1G2]
Mouse monoclonal [185-1G2] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
Western Blot - Anti-CD36 Antibody [CD36/7217] - BSA and Azide free (A278442) - Antibodies.com
(2)
A278442
Anti-CD36 Antibody [CD36/7217] - BSA and Azide free
Mouse monoclonal [CD36/7217] antibody to CD36 for Functional Studies, WB and IHC-P.
Western Blot - Anti-CD36 Antibody (C30346) - Antibodies.com
(2)
A98246
Anti-CD36 Antibody
Rabbit polyclonal antibody to CD36 for WB and ELISA.
Western Blot - Anti-CD36 Antibody [CD36/7217] (A277854) - Antibodies.com
(2)
A277854
Anti-CD36 Antibody [CD36/7217]
Mouse monoclonal [CD36/7217] antibody to CD36 for Functional Studies, WB and IHC-P.
SDS-PAGE - Anti-CD36 Antibody [185-1G2] - BSA and Azide free (A253865) - Antibodies.com
A253866
Anti-CD36 Antibody [185-1G2] - BSA and Azide free
Mouse monoclonal [185-1G2] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-CD36 Antibody [1A7] (A250686) - Antibodies.com
A250687
Anti-CD36 Antibody [1A7]
Mouse monoclonal [1A7] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-CD36 Antibody [1A7] - BSA and Azide free (A253866) - Antibodies.com
A253867
Anti-CD36 Antibody [1A7] - BSA and Azide free
Mouse monoclonal [1A7] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-CD36 Antibody [1E8] (A250687) - Antibodies.com
A250688
Anti-CD36 Antibody [1E8]
Mouse monoclonal [1E8] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-CD36 Antibody [1E8] - BSA and Azide free (A253867) - Antibodies.com
A253868
Anti-CD36 Antibody [1E8] - BSA and Azide free
Mouse monoclonal [1E8] antibody to CD36 for Functional Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-CD36 Antibody [GPIIIb/1654] - BSA and Azide free (A253868) - Antibodies.com
A253869
Anti-CD36 Antibody [GPIIIb/1654] - BSA and Azide free
Mouse monoclonal [GPIIIb/1654] antibody to CD36 for Flow Cytometry and IF.
Antibodies.com Image Placeholder - Discover more for less
A281186
Anti-CD36 Antibody [MF3]
Rat monoclonal [MF3] antibody to CD36 for WB, IF and Flow Cytometry.
Antibodies.com Image Placeholder - Discover more for less
A281187
Anti-CD36 Antibody [MF3] - BSA and Azide free
Rat monoclonal [MF3] antibody to CD36 for IF, Flow Cytometry and Functional Assays.
See all Anti-CD36 Antibodies
Main Menu Contact Us 0Checkout
Top