Anti-CEBP Beta Antibody [ARC0017] (A308846)

Anti-CEBP Beta Antibody [ARC0017]

Rabbit monoclonal [ARC0017] antibody to CEBP Beta.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 246-345 of human C/EBPB (P17676).

TACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

Rabbit

Monoclonal

ARC0017

IgG

Affinity purification.

32 - 47 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AGP/EBP, C EBP beta, C/EBP beta, C/EBP related protein 2, CCAAT Enhancer Binding Protein beta, CCAAT/enhancer-binding protein beta, CEBPB, CEBPB_HUMAN, CRP2, IL 6DBP, IL6DBP, Interleukin 6 dependent binding protein, LAP, Liver activator protein, Liver enriched transcriptional activator, NF IL6, NFIL6, Nuclear factor NF IL6, Nuclear factor NF-IL6, SF B, SFB, Silencer factor B, TCF-5, TCF5, Transcription factor 5