Anti-BORIS Antibody (A15089)

Anti-BORIS Antibody

Rabbit polyclonal antibody to BORIS.

WB: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 291-370 of human CTCFL (NP_542185.2).

LKTFRTVTLLRNHVNTHTGTRPYKCNDCNMAFVTSGELVRHRRYKHTHEKPFKCSMCKYASVEASKLKRHVRSHTGERPF

Rabbit

Polyclonal

IgG

Unconjugated

83 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

BORIS like protein, Brother of the regulator of imprinted sites, Cancer/testis antigen 27, CCCTC binding factor (zinc finger protein) like, CCCTC-binding factor, CT27, CTCF paralog, CTCF T, CTCF-like protein, Ctcfl, CTCFL_HUMAN, dJ579F20.2, HMG 1L1, HMGB1L1, MGC163358, MGC169105, MGC169106, Putative high mobility group protein 1 like 1, Putative high mobility group protein B1 like 1, Transcriptional repressor CTCFL, Zinc finger protein CTCF-T