Anti-eIF5A Antibody [ARC0999] (A306839)

Anti-eIF5A Antibody [ARC0999]

Rabbit monoclonal [ARC0999] antibody to eIF5A.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF5A (P63241).

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLS

Rabbit

Monoclonal

ARC0999

IgG

Affinity purification.

18 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

eIF 4D, EIF 5A, eIF 5A 1, eIF 5A1, eIF-4D, eIF-5A, eIF-5A-1, eIF-5A1, eIF4D, EIF5A1, eIF5AI, Eukaryotic initiation factor 5A, Eukaryotic initiation factor 5A isoform 1, Eukaryotic translation initiation factor 5A, Eukaryotic translation initiation factor 5A 1, Eukaryotic translation initiation factor 5A-1, IF5A1_HUMAN, MGC104255, MGC99547, Rev binding factor, Rev-binding factor, uORF, uORF A