Anti-FAIM2 Antibody (A91904)

Anti-FAIM2 Antibody

Rabbit polyclonal antibody to FAIM2.

WB: 1:500-1:2000

Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human FAIM2 (NP_036438.2).

MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRK

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Fas apoptotic inhibitory molecule 2, KIAA0950, LFG, LFG2, Neural membrane protein 35, NMP35, Protein lifeguard 2, TMBIM2, Transmembrane BAX inhibitor motif-containing protein 2