+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683)

Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) - Antibodies.com Immunohistochemistry - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) - Antibodies.com Immunofluorescence - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) - Antibodies.com Immunofluorescence - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) for WB, IHC and ICC/IF.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Highlighted products for Anti-Glutamate Receptor 1 (AMPA subtype) Antibody

Western Blot - Anti-GluR1 Antibody (B7094) - Antibodies.com
(5)
A95231
Anti-GluR1 Antibody
Rabbit polyclonal antibody to GluR1 for WB, IHC, IF and ELISA.
Anti-Glutamate Receptor 1 Antibody from FabGennix (GLUR1-101AP) - Antibodies.com
A52259
Anti-Glutamate Receptor 1 Antibody
Rabbit polyclonal antibody to Glutamate Receptor 1 for ELISA and WB.
Western Blot - Anti-GluR1 Antibody (B7094) - Antibodies.com
(5)
A95231
Anti-GluR1 Antibody
Rabbit polyclonal antibody to GluR1 for WB, IHC, IF and ELISA.
Anti-Glutamate Receptor 1 Antibody from FabGennix (GLUR1-101AP) - Antibodies.com
A52259
Anti-Glutamate Receptor 1 Antibody
Rabbit polyclonal antibody to Glutamate Receptor 1 for ELISA and WB.
Name
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody
Description
Rabbit polyclonal antibody to Glutamate Receptor 1 (AMPA subtype).
Applications
WB, IHC, ICC/IF
Dilutions
WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR1/GRIA1 (NP_000818.2).
Sequence
PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPD
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
100 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
AMPA 1, AMPA selective glutamate receptor 1, AMPA-selective glutamate receptor 1, GluA1, GLUH1, GLUR 1, GLUR A, GluR K1, GluR-1, GluR-A, GluR-K1, GLUR1, GLURA, GluRK1, Glutamate receptor 1, Glutamate receptor ionotropic, Glutamate receptor ionotropic AMPA 1, Glutamate receptor, ionotropic, AMPA 1, Gria1, GRIA1_HUMAN, HBGR1, MGC133252, OTTHUMP00000160643, OTTHUMP00000165781, OTTHUMP00000224241, OTTHUMP00000224242, OTTHUMP00000224243
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683)
Western blot analysis of various lysates, using Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683)
Immunohistochemistry analysis of paraffin-embedded mouse brain using Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) - Antibodies.comEnlarge Image
Figure 3: Immunofluorescence - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683)
Immunofluorescence analysis of rat brain cells using Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).
Immunofluorescence - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) - Antibodies.comEnlarge Image
Figure 4: Immunofluorescence - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683)
Immunofluorescence analysis of mouse brain cells using Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).
Publishing research using Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Glutamate Receptor 1 (AMPA subtype) Antibody (A13683)

Western Blot - Anti-GluR1 Antibody (B7095) - Antibodies.com
(5)
A95232
Anti-GluR1 Antibody
Rabbit polyclonal antibody to GluR1 for WB, IHC, IF and ELISA.
Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [S355-1] (A304766) - Antibodies.com
(3)
A304766
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [S355-1]
Mouse monoclonal [S355-1] antibody to Glutamate Receptor 1 (AMPA subtype) for WB, IHC and ICC/IF.
Immunohistochemistry - Anti-GluR1 (phospho Ser863) Antibody (A7095) - Antibodies.com
(2)
A94199
Anti-GluR1 (phospho Ser863) Antibody
Rabbit polyclonal antibody to GluR1 (phospho Ser863) for WB, IHC and ELISA.
Antibodies.com Image Placeholder - Discover more for less
A282795
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody
Rabbit polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) for WB, IHC-Fr and IP.
Antibodies.com Image Placeholder - Discover more for less
A283961
Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser831) Antibody
Rabbit polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) (phospho Ser831) for WB.
Immunohistochemistry - Anti-GluR1 (phospho Ser849) Antibody (A7094) - Antibodies.com
A93699
Anti-GluR1 (phospho Ser849) Antibody
Rabbit polyclonal antibody to GluR1 (phospho Ser849) for IHC and ELISA.
Immunohistochemistry - Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser845) Antibody [RM296] (A121406) - Antibodies.com
(2)
A121301
Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser845) Antibody [RM296]
Recombinant rabbit monoclonal [RM296] antibody to Glutamate Receptor 1 (AMPA subtype) (phospho Ser84 for WB and IHC.
Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser849) Antibody (A16539) - Antibodies.com
A16539
Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser849) Antibody
Rabbit polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) (phospho Ser849) for WB.
Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser836) Antibody (A16594) - Antibodies.com
A16594
Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser836) Antibody
Rabbit polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) (phospho Ser836) for WB.
Western Blot - Anti-GRIA1 Antibody (A82973) - Antibodies.com
A82973
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody
Goat polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) for ELISA and WB.
Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [ARC0657] (A80695) - Antibodies.com
A80695
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [ARC0657]
Rabbit monoclonal [ARC0657] antibody to Glutamate Receptor 1 (AMPA subtype) for WB.
Western blot - GluR-1 Polyclonal Antibody from Signalway Antibody (40966) - Antibodies.com
(2)
A34384
Anti-GluR-1 Antibody
Rabbit polyclonal antibody to GluR-1 for WB, IHC, IF and ELISA.
Western Blot - Anti-GluR1 Antibody (B7095) - Antibodies.com
(5)
A95232
Anti-GluR1 Antibody
Rabbit polyclonal antibody to GluR1 for WB, IHC, IF and ELISA.
Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [S355-1] (A304766) - Antibodies.com
(3)
A304766
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [S355-1]
Mouse monoclonal [S355-1] antibody to Glutamate Receptor 1 (AMPA subtype) for WB, IHC and ICC/IF.
Immunohistochemistry - Anti-GluR1 (phospho Ser863) Antibody (A7095) - Antibodies.com
(2)
A94199
Anti-GluR1 (phospho Ser863) Antibody
Rabbit polyclonal antibody to GluR1 (phospho Ser863) for WB, IHC and ELISA.
Antibodies.com Image Placeholder - Discover more for less
A282795
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody
Rabbit polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) for WB, IHC-Fr and IP.
Antibodies.com Image Placeholder - Discover more for less
A283961
Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser831) Antibody
Rabbit polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) (phospho Ser831) for WB.
Immunohistochemistry - Anti-GluR1 (phospho Ser849) Antibody (A7094) - Antibodies.com
A93699
Anti-GluR1 (phospho Ser849) Antibody
Rabbit polyclonal antibody to GluR1 (phospho Ser849) for IHC and ELISA.
Immunohistochemistry - Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser845) Antibody [RM296] (A121406) - Antibodies.com
(2)
A121301
Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser845) Antibody [RM296]
Recombinant rabbit monoclonal [RM296] antibody to Glutamate Receptor 1 (AMPA subtype) (phospho Ser84 for WB and IHC.
Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser849) Antibody (A16539) - Antibodies.com
A16539
Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser849) Antibody
Rabbit polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) (phospho Ser849) for WB.
Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser836) Antibody (A16594) - Antibodies.com
A16594
Anti-Glutamate Receptor 1 (AMPA subtype) (phospho Ser836) Antibody
Rabbit polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) (phospho Ser836) for WB.
Western Blot - Anti-GRIA1 Antibody (A82973) - Antibodies.com
A82973
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody
Goat polyclonal antibody to Glutamate Receptor 1 (AMPA subtype) for ELISA and WB.
Western Blot - Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [ARC0657] (A80695) - Antibodies.com
A80695
Anti-Glutamate Receptor 1 (AMPA subtype) Antibody [ARC0657]
Rabbit monoclonal [ARC0657] antibody to Glutamate Receptor 1 (AMPA subtype) for WB.
Western blot - GluR-1 Polyclonal Antibody from Signalway Antibody (40966) - Antibodies.com
(2)
A34384
Anti-GluR-1 Antibody
Rabbit polyclonal antibody to GluR-1 for WB, IHC, IF and ELISA.
See all Anti-Glutamate Receptor 1 (AMPA subtype) Antibodies
Main Menu Contact Us 0Checkout
Top